PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G038100.1
Common NameB456_013G038100, LOC105784034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 362aa    MW: 40503.3 Da    PI: 5.5158
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G038100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH36.58.5e-12189242154
                         CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                 HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                         +++ hn+ Er RR ++  a+  L  llP++s +++k+ s a i  +AveYI +L
  Gorai.013G038100.1 189 KKQEHNAKERIRRMKLHAAYLALGALLPSDSTGSKKRKSTALIIDRAVEYIPEL 242
                         6899*************************85555555**************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474598.77E-12184253IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.443188242IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.3E-9188260IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.8E-9189243IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.6E-6194248IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MSSLHLENLF SIPEATDEYL WPLTQDNKDD GKNFSASIQT DGHQCSSSSS QAVMDNVNGN  60
KLDPVLALDQ GIPALLSDYT IEDNARTGDQ LGTTSKFILE SVDHNIVGES MESILDYPID  120
VSLSAPLEDL DDIDLVPHES SSRQLPSTYQ ETGDAHINAK RISSKTRGRN HRFKQGLNME  180
DNGEGTTMKK QEHNAKERIR RMKLHAAYLA LGALLPSDST GSKKRKSTAL IIDRAVEYIP  240
ELEKEIEKLT LRKNDMLSTI KNKKSCAVLN HFQLRQPSVS VHEIKQGEFI VQICTQEYPD  300
CSFLNLLHNV EEEEGICIIS ASTHQVSDHG HCYHLHIQMH ERLDGENHIA SLREKLMYSQ  360
G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6145441e-155JX614544.1 Gossypium hirsutum clone NBRI_GE58013 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465250.10.0PREDICTED: transcription factor ORG2 isoform X1
TrEMBLA0A0D2V9W80.0A0A0D2V9W8_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105582234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71200.13e-20bHLH family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]